DPCstruct | MC13391
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 68 ± 7 aa |
| Standard deviation of domain lengths | 6.73 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 42.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V8G785 | 126-188 | ARNEPPTWPCDACGKAATAICTQCLYEGKGFCCAAHASNHDCGEEMLSPVVNSPRMGVCGYTG |
| A0A7K3YCS5 | 1-70 | VEVVARNDPPEIPCSICGEPATEICLECLYEKDVEDPFFCDACFEKHECDEEMSLPVVNSPRMGQCAYMG |
| A0A1V5MCE0 | 44-116 | None |
| A0A1F8F9A2 | 1-81 | None |
| A0A2R6KH01 | 152-219 | None |
| A0A7R9N6D3 | 78-157 | None |
| A0A7W1CYG0 | 1-61 | None |
| A0A4Y6PVY0 | 169-226 | None |
| A0A7C4PB79 | 54-128 | None |
| A0A1F8JNA4 | 51-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.