DPCstruct | MC13390
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 137 ± 21 aa |
| Standard deviation of domain lengths | 20.97 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 93.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 39.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A843D6K1 | 204-329 | HAKRFKQFKESVREKFDLPMLKKVLPQGTVLADAVVEVSGNISFARQLGSYPILIGIPYELPVGTVGDFFVTDWGYRSVTAFQKPFR… |
| A0A7K3Y5E2 | 14-139 | HDARFRAFKEWTRKEFDEPMLARVFPPGTILRDIVIEVAGKPSFGRQMGSYPILVGIPLTLPERAVLDAVVVDRGMRSVTALPCPVE… |
| A0A7J2H7F3 | 38-178 | None |
| A0A7C3AP96 | 96-222 | None |
| A0A7M3ZJ88 | 40-239 | None |
| A0A7C2ALF8 | 1-123 | None |
| A0A7J2J4H5 | 63-201 | None |
| A0A7J4UZX2 | 1-115 | None |
| A0A843LXN1 | 242-365 | None |
| A0A534IWM7 | 156-295 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.