DPCstruct | MC1339
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 168 ± 23 aa |
| Standard deviation of domain lengths | 23.26 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 27.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M3DRN5 | 2-125 | RTLKQLNNPFSVENMQIALDSLLANKESLNGSMRAPSALDEFEITATDLYIRYLPKDSTEYRTLMNDSTLTLFDFPLDYEWKQIGEY… |
| A0A553EAZ8 | 1-187 | MKLFLGLILLTSIVSCSNESNLLESVSKSTSEDWIKKGVKLENPYSVKNMKLALQNLKNKNASSKSNVEAIDDNFEIEPTHLYVKFE… |
| A0A327R6B0 | 1-193 | None |
| A0A0A2ETB6 | 1-182 | None |
| A0A7Y4X144 | 29-167 | None |
| A0A7W1V1H0 | 2-185 | None |
| A0A1V5G9X5 | 7-158 | None |
| A0A1V5YN41 | 3-220 | None |
| A0A132HZ25 | 21-157 | None |
| A0A2T4WXB4 | 16-205 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.