DPCstruct | MC13389
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 384 ± 35 aa |
| Standard deviation of domain lengths | 34.61 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 27.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S9BZA7 | 1-319 | MGGTKDSAGLVPDAVDLSGLTEIRVHGVGGTPPEALLGDMKPTRVAGDRIAGFYRTADARGRHREAYSWGGLTSHSPLRVLWTPLLP… |
| A0A3N5A116 | 294-679 | ATAPRPQPAPDQQPLLVLELLVHGIDGATPEQMLGDPRVVRVGGDDVAALHRKAEDTDAEQRPEDYRDHPVPEAYTWARLAPGTSPG… |
| A0A2P7ADS6 | 5-404 | None |
| B4VB86 | 113-458 | None |
| A0A2A3GU09 | 81-505 | None |
| A0A2P2CFD2 | 11-399 | None |
| A0A4D4N2R8 | 23-424 | None |
| A0A1Q9SV05 | 4-354 | None |
| A0A7J5CL53 | 4-345 | None |
| A0A1C6SH41 | 2-420 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.