DPCstruct | MC13382
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 163 ± 20 aa |
| Standard deviation of domain lengths | 19.53 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 17.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B7TM03 | 2-147 | QDNYIYVENVKESDLLKALQDLANLYSNTGFTDEINLYRKKDNSDLYSIVFTNLPDFDRFSYFVNCLYLPIELDNFEPKIRGFYQVK… |
| A0A2W5L5Y3 | 1-199 | MHATGSMVALLLAMTAVIPKAWGASPDPDFTASQGWILVHHGSPHEVQKAIAEYDEITREIHPGVFRIELHPQRDGRVAVLLPDGLP… |
| A0A6C9IJY4 | 135-277 | None |
| A0A6A2ETS9 | 43-188 | None |
| A0A3E4Z6E2 | 1-161 | None |
| A0A0M9VI43 | 3-159 | None |
| A0A328WXF3 | 62-255 | None |
| A0A1T5IGR1 | 5-171 | None |
| A0A5C8K974 | 3-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.