DPCstruct | MC13381
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 180 ± 9 aa |
| Standard deviation of domain lengths | 9.41 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 93.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 27.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0088 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G2F2U8 | 114-301 | GSYWFDFSTGQFITSSFFKKELPKWVLDFNAQKQADNYLEKEWNTILDISEYTESGPDDSPYEHLLPDKTTPTFPYNLKEMTRGQAN… |
| A0A7X1LBP2 | 1-184 | MGKAYWYSTNNGQFASSTYYFKEFPGWVSKWNEQKKADAYYEKHWKLSRPKSTYKNSFQDDRPYENPHDLGYGKVFPHPFGGKDNKY… |
| A0A3P0XEU3 | 74-263 | None |
| A0A7V2CJQ4 | 348-538 | None |
| A0A2N2F5U0 | 191-372 | None |
| A0A1F2SV64 | 203-359 | None |
| A0A6M5XU23 | 29-209 | None |
| A0A2N1FAX8 | 107-279 | None |
| A0A838REQ9 | 480-659 | None |
| A0A2V7YNN4 | 176-353 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.