DPCstruct | MC13380
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 180 ± 24 aa |
| Standard deviation of domain lengths | 23.65 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 40.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05524- CL0161 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A252EVV9 | 108-281 | FLAVPIIYQKAVVGVIVVQQASARQFSEGEEAFLMTLAAQLAMAIRGLKQKAQVSSLHQQILFQGTSASSGIAIAHALVLGGEISLE… |
| A0A7X1L1P4 | 1-239 | MSRATTCSMCVDLPVRCCPGSKSGCTSKIQVLRKKWRRDLQHISGVPLVHLRNPLGVLVVQTVQEDAISKADMNLFTTIASQISATV… |
| A0A7U1VEL1 | 110-283 | None |
| A0A377K1B7 | 26-184 | None |
| A0A0W1A545 | 110-301 | None |
| A0A7H4M6V2 | 36-209 | None |
| A0A376IZL1 | 1-151 | None |
| W7QF64 | 58-234 | None |
| A0A3M1ZWX4 | 114-296 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.