DPCstruct | MC1338
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 213 ± 14 aa |
| Standard deviation of domain lengths | 14.32 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 73.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 16.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0176 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A240SXS8 | 4-203 | KKLTKLIVPENIYSAHRPIFIFLFFSGLFPFRVVKKDGKTGLVLTFYGLLSTTFHLIFFGVCYVRTMKLKQSIIGYFLASDITTVGD… |
| A0A6I8TVC4 | 5-205 | QARNFFDSFRPVYLATKIFHIHFETLDFKQQTVRRTLLDQFRFVFTMMVDVYFIYRSIVLNLPYLYLTESVLLNVGNYLSLVLLSML… |
| A0A6J1LL81 | 2-214 | None |
| F4WSQ7 | 9-226 | None |
| A0A6J2U9K8 | 4-231 | None |
| A0A1I8NEP9 | 16-227 | None |
| T1GNH5 | 7-240 | None |
| A0A835CRB2 | 806-1013 | None |
| A0A182FRY3 | 490-691 | None |
| A0A1A9WEQ3 | 2-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.