DPCstruct | MC13379
Metacluster Properties and Pfam Annotations
| Number of structural domains | 753 |
|---|---|
| Mean domain length (aa) | 262 ± 51 aa |
| Standard deviation of domain lengths | 50.76 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 83.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.39 |
| Mean intra-cluster sequence similarity (%) | 12.19 |
| Pfam Score | 92.62 |
| Assigned Pfam label(s) | CL0323- CL0125- PF17951- CL0257- CL0042 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K1J1X0 | 3-176 | AMYDKGKAAVVVTEAETKLKTGELLWTTRSSVFIRGEGGWDGERGPSGPQNEPPAKAPDHEVTLQTSPDQAFVYRLSGDRNPLHTDP… |
| A0A7X1H0G6 | 37-292 | AAAGRASTTVRADSLHVNADGTLDPTAHLELMGQTFAAAKSWRDRQQGRPPRVGFLAGATGMDCLDTARIGDQLTIVIKQTGAFGAF… |
| A0A2R8ATV1 | 26-325 | None |
| A0A0F7SCW6 | 441-789 | None |
| N4WEB0 | 16-159 | None |
| A0A3D3Q8A9 | 30-276 | None |
| A0A538QN24 | 105-276 | None |
| A0A538QT77 | 352-612 | None |
| A0A3S0Z7I3 | 104-361 | None |
| A0A099P5Y9 | 377-634 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.