DPCstruct | MC13378
Metacluster Properties and Pfam Annotations
| Number of structural domains | 77 |
|---|---|
| Mean domain length (aa) | 108 ± 22 aa |
| Standard deviation of domain lengths | 21.57 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 79.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 14.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A521KQH9 | 362-454 | ATFVPEDGSVLVRVAPVAGFQGLMRVQDALARLRGIRQTAVEAYSQGEARLRLELTEVTDSDEIADGLAGTLSVPAQVRDASESERS… |
| A0A7X1GZI5 | 137-231 | VLADARPAVRLSLSVMGTDNLSSFVLFRSNLNKMEGVESVQIREILPNQTTLSVSYRGSAGAFAEALLREQHDGFTTRVYQESDNAF… |
| C2G0Q9 | 31-154 | None |
| A0A1T4RCX8 | 176-270 | None |
| A0A661NUB4 | 168-268 | None |
| A0A3A0CKP4 | 22-104 | None |
| A0A356KWN3 | 457-559 | None |
| A0A2D5US87 | 4-170 | None |
| A0A7K0PET9 | 1-89 | None |
| A0A351RSS1 | 294-407 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.