DPCstruct | MC13377
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 98 ± 7 aa |
| Standard deviation of domain lengths | 7.24 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 16.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A522CT11 | 7-96 | VVSEYEVFKNGRNALAFFFYRHPTLDGNPEEGPFWFTIQENRIVAGTETNYAIFEDVSQTVLDTARQRGVIMLVEFENQQPVRCTPC… |
| R5QPP2 | 6-104 | IINLEYDFIDNGNGDLMMLIQAVPDSPAAPVFYFDGLNAALFKRSDNQLAPIAYIPAKVRKLLTQIEQILVAEMNDDEEFGEVYKAP… |
| A0A7C7WSQ4 | 18-124 | None |
| A0A502YF87 | 275-371 | None |
| A0A7T5R498 | 15-117 | None |
| A0A7T5R307 | 1-90 | None |
| A0A2W5FMH2 | 3-90 | None |
| A0A3R9QGJ9 | 1-91 | None |
| A0A1Q6UAC5 | 5-102 | None |
| A0A2D6TTT4 | 25-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.