DPCstruct | MC13373
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 136 ± 19 aa |
| Standard deviation of domain lengths | 19.04 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 76.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 22.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A847BMY8 | 22-167 | ETAQTTAETAQSTADNANAAVSELGDTVGTVEENISNVQSDVSDLQVAVDESAKQDQLDAVNELVRQYIGSEGYVHIAGGTLMIGVG… |
| A0A1L8MKA0 | 3-132 | QLNYLIASYQEYTQNNDADKAKSEADLAMLTQSLNETVTNLANIAQRWNFLDNYFKVGEEGLIFADKNGTAAAKMSKDRFSIFSAGA… |
| G5KEK5 | 618-749 | None |
| A0A6N2T265 | 733-861 | None |
| A0A6A8SIH4 | 687-788 | None |
| A0A087AF58 | 925-1029 | None |
| A0A2S0L5T0 | 190-356 | None |
| R9LQS1 | 478-626 | None |
| A0A7X9KYI0 | 110-238 | None |
| A0A645I1N2 | 1-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.