DPCstruct | MC1337
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 64 ± 5 aa |
| Standard deviation of domain lengths | 5.49 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 56.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A9P8H3 | 1-62 | MDSQIKHAVVMKIMGRTGSRGQVTQVRVKFLDDPNRFIMRNVKGPVREGDVLTLLESEREAR |
| A0A1B0GL06 | 2-62 | EKPVVLARVIKVLGRTGSQGQCTQVKVEFIGEVNRQIIRNVKGPVREGYVRTIICDFCPES |
| A0A6P5N4L0 | 19-83 | None |
| A0A7J4JDJ1 | 18-93 | None |
| A0A497I363 | 27-91 | None |
| A0A0H5BKM3 | 14-86 | None |
| A0A7R9KME6 | 504-564 | None |
| B5DH72 | 1-58 | None |
| A0A4U0W6G4 | 86-149 | None |
| A0A507FDV4 | 564-629 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.