DPCstruct | MC13367
Metacluster Properties and Pfam Annotations
| Number of structural domains | 88 |
|---|---|
| Mean domain length (aa) | 53 ± 8 aa |
| Standard deviation of domain lengths | 7.52 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 56.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00253 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A819TQU7 | 2-45 | KYGPGSRMCRVCSNGHGIIRKYGLMICRQCFRQYSSDIGFKKLD |
| I3EM80 | 12-64 | LRVLEKSEIPMGKGSRQCRSCMGRRGLIRQYELMMCRRCFREYATDIGFEKLN |
| A0A7R8A0U6 | 1-60 | None |
| E1C3G8 | 110-164 | None |
| D3B2B2 | 2-43 | None |
| A0A5B7CIV0 | 6-61 | None |
| A0A194PFU6 | 1-60 | None |
| A0A7D8V1G8 | 95-145 | None |
| A0A183HH35 | 18-65 | None |
| A0A4U5UNP0 | 18-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.