DPCstruct | MC13366
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 512 ± 62 aa |
| Standard deviation of domain lengths | 62.11 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 21.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U8I5V6 | 84-590 | SRKKTMMETVSETLHFIILGKIENIQREYINLWIQQHSHYKIKTWTDNNTYLSREIFVRIQKKASQETFDDTNTDNNDFYTFFKSNV… |
| A0A2R7TF17 | 92-513 | ADTLTLLKDEGRPVPKIMHFVWVGGSEVGVNQRDYMNIWRQILEPQGYRFNLWYDSDALLAFEMNRVILDAARVDAMEAGGDTLSKP… |
| Q9EXR0 | 88-632 | None |
| O68653 | 84-635 | None |
| A0A828U171 | 255-672 | None |
| G2GXI0 | 99-655 | None |
| A0A3N2QBB3 | 137-721 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.