DPCstruct | MC13363
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 119 ± 14 aa |
| Standard deviation of domain lengths | 13.93 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 21.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A316ZWD7 | 2-96 | TGASATASVPADGVPRFVTDLFRGSAISSASGDILGTSAQLTGFQDLTKCQLLNLNIPGWTIDLDGRAKNFVDLDGDVTKPIPTWLN… |
| A0A0L1IVC2 | 2-110 | ATSSVIAGPTNVQSVTVQLSNEQSGANANVDIPTDGNPRSIQALWGHTSVVVNGVVSASSAQFNRFQQTSVCHIFQHPNVNAELNAR… |
| A0A6A5KKA1 | 362-484 | None |
| A0A5N5WM39 | 9-128 | None |
| A0A178AA39 | 1-132 | None |
| A2R343 | 17-125 | None |
| A0A218ZFY0 | 1-120 | None |
| A0A2T2N527 | 2-116 | None |
| A0A1J9QCK9 | 76-207 | None |
| A0A0D2B4K5 | 2-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.