DPCstruct | MC13360
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 263 ± 29 aa |
| Standard deviation of domain lengths | 28.83 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 74.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 24.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L1IKT2 | 49-316 | TETDRLVEPIVTSQGDVSLDVGAVCPGQNRRSYQRFYQALTAQWLAVEMLWLARISVYDTPSDQHRYFVQVWKIWGDNRSRTLQEKL… |
| A0A2I1CRX6 | 67-314 | KESNRYRDRLAAEDPLAPPAGVTITIDSAAQEKQALWRAYERFYQALTLHWAVIETLCLARAASYTSSTERNARFEHIWTQWTDTAR… |
| A0A401KR91 | 293-559 | None |
| A0A7R7WCE0 | 30-283 | None |
| A0A0F4Z1T2 | 102-367 | None |
| A0A5M9MH80 | 17-295 | None |
| A0A6V8HQ14 | 5-255 | None |
| G3Y9T5 | 25-241 | None |
| R7YHE3 | 71-405 | None |
| A0A5M9M478 | 11-257 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.