DPCstruct | MC1336
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 244 ± 31 aa |
| Standard deviation of domain lengths | 30.95 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.20 |
| Pfam Score | 95.83 |
| Assigned Pfam label(s) | CL0186- PF16062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B0GJ53 | 25-272 | HKCVKDILTQSKDIQIPKAHSIRELIANSDEMGLRFPNERYRLRNQPPSSHPSIKEEASSVYPFVFENVFVLFCKFLEHKLKYGSEI… |
| V5GUD9 | 2-248 | ALPDWSPKSPEWSKDEKKLVLEDIISEPTKQSLKDIISNSDEFPIKFPIDTGRCKTLTSYLTESTLERNINSVYPLIHENALELYCK… |
| A0A7T9BJU9 | 499-785 | None |
| A0A3R7MBW7 | 138-378 | None |
| A0A7T8YRE3 | 415-599 | None |
| A0A7T9BJG0 | 112-396 | None |
| A0A0L0S653 | 388-640 | None |
| A0A0L0T404 | 764-1006 | None |
| A0A3M1SXS1 | 5-247 | None |
| A0A2P8YBY1 | 3-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.