DPCstruct | MC13357
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 106 ± 16 aa |
| Standard deviation of domain lengths | 16.40 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 53.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287GHB0 | 57-154 | AGEMLAYAHDTQHEKIIRGLALGIALTMYGREEEADTLIEQMIRDQDPILRYGGMYALALAYRGTANNKAIHQLLHFAVSDVSDDVR… |
| A0A086QCL3 | 305-402 | VDELLAYAQDTQHEKIRRACGIAVALLMFKKEQEADALIDQLCKDSDALIRYGGMFTIAMAYCATANSGAIRRLLHVSVSDVSDDVR… |
| R4XB38 | 490-605 | None |
| B9RWJ0 | 544-641 | None |
| A0A812S8Z6 | 2-97 | None |
| A0A812PWP7 | 443-561 | None |
| A0A662YUZ9 | 812-894 | None |
| U6GQC9 | 669-810 | None |
| A0A6U4DCK8 | 556-655 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.