DPCstruct | MC13353
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 259 ± 28 aa |
| Standard deviation of domain lengths | 27.94 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 18.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16061 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J1TJ15 | 1-280 | MVTIFVPAFSSASVEDSLPGVRRRERKLLSHIAEVSRLVGQVQRSVQASSEATVRALMTDLPDIVRLELRLDRLTEIMDGVAVRDAE… |
| A0A834HPU5 | 18-230 | EIYLVDHLIEFDKALRQMSDDIVEPMTPARSTIWLLELYPELRHIDNLYEKFRQYLRDQKEVITVSKKSIDDSIDADEMIRDIRNVQ… |
| A0A2P8YCU6 | 9-291 | None |
| A0A835CSL2 | 56-302 | None |
| A0A6P5VEG3 | 1-295 | None |
| A0A5E4Q8A6 | 198-437 | None |
| A0A336LXQ3 | 65-295 | None |
| A0A5E4Q6S5 | 1-282 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.