DPCstruct | MC13352
Metacluster Properties and Pfam Annotations
| Number of structural domains | 231 |
|---|---|
| Mean domain length (aa) | 189 ± 38 aa |
| Standard deviation of domain lengths | 38.45 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 75.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 17.02 |
| Pfam Score | 96.84 |
| Assigned Pfam label(s) | CL0123- CL0255- CL0530 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A653CCL3 | 5-122 | FPLRTQESLSQLEAFLNNSDNMVALAKELSKMGGDSAKELAKKILYRCLTNELGQEFSWEGAKGKRPFKNLLLSQAVLKAVRFNKRT… |
| A0A6J1THC3 | 97-300 | GSKAGSPRSDYYSNNSEDEDYFDADLTAGERRILAKLHEMNKKMTNINDRLGKLESDVVLVGSTVSRTARHIMPHQKKVAKPQGMPD… |
| A0A3L8DSU8 | 875-1056 | None |
| A0A7J7A2Q4 | 111-306 | None |
| A0A7J7A630 | 89-237 | None |
| A0A182WQ64 | 103-275 | None |
| A0A0Q9W8A0 | 21-194 | None |
| A0A6A5FQ95 | 400-557 | None |
| A0A6A5FSH2 | 7-179 | None |
| A0A1Y1LF32 | 8-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.