DPCstruct | MC13351
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 179 ± 20 aa |
| Standard deviation of domain lengths | 20.32 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J1TEU0 | 58-248 | VRPTEQLESKLPLLWCQVLHLAHRQISQSGDRNTAASSLHQLVQHAETVADHKAGGWGLLSAIGIGKQLSVSPRCRLLCRFLCAYVS… |
| G3HAE5 | 6-147 | SVLTESIIRILLMLQSRQSLMAEERLSSGILGAIGLGRKSPLSNRFRVIARGMAAFLLVQVPAEDQVRLKPSSELHLTPKAQQVLTA… |
| A0A3Q0J2S5 | 180-394 | None |
| A0A0W8BYX7 | 929-1117 | None |
| A0A7E4SC34 | 7-160 | None |
| A0A1Y1N8S4 | 2-172 | None |
| A0A5B7EQ72 | 2-171 | None |
| A0A5N4CBQ0 | 887-1063 | None |
| A0A4Z2FCD0 | 361-560 | None |
| A0A3P7Q0T3 | 11-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.