DPCstruct | MC13350
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 300 ± 48 aa |
| Standard deviation of domain lengths | 47.54 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 71.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.88 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 23.79 |
| Pfam Score | 89.50 |
| Assigned Pfam label(s) | PF04935- PF15459 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J1TE70 | 9-297 | KVNLDRLREKLNSEYNFITSVLDRVPSIYWQGNSNDGTDEAENAEGSKWKPDAGSKVVANANKKPRATTIEELQERLEACKAKKAQG… |
| A0A7F8Q8G6 | 2-213 | FAPFLQGHNTELSPATLEKRRRRKQERDRKKRKRRELRAKEKVAKATEAAKPPHELSHEQPHEEVQPGLLFNKVEVTEEQAASKAQR… |
| A0A2N1JEF0 | 51-387 | None |
| A0A3P7IWA7 | 107-358 | None |
| H0ELA9 | 4-299 | None |
| B6AB18 | 45-279 | None |
| T1PJW2 | 1-213 | None |
| T1F8A0 | 2-305 | None |
| A0A4Y9XVV6 | 550-896 | None |
| A0A5C6NJY0 | 1-269 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.