DPCstruct | MC1335
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 101 ± 21 aa |
| Standard deviation of domain lengths | 21.11 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 71.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 57.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B0GID6 | 55-198 | KSSVISLSSSSTAGADDEDEEEICLVPEVNFEGINLDPAGIDNRESQPLLGGRDCPDTAINSFPDDPQFSELVNQAEIAIEHGIYPE… |
| A0A5E8B4U1 | 357-439 | ATQAEFDAIIDDAIESIESLHINPKLISQGSSGSYFVYNTSGTIVGVFKPKDEEPYGPLSPKWTKWLHRNLFPCFFGRSCLIP |
| A0A1X2HEF7 | 207-325 | None |
| A0A7J8GA74 | 82-188 | None |
| A0A820CUM5 | 2-91 | None |
| A0A7T8K850 | 2-95 | None |
| A0A6I8VPP1 | 6-72 | None |
| A0A822F072 | 14-97 | None |
| M5G8X0 | 1-87 | None |
| A0A6H2EES5 | 9-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.