DPCstruct | MC13349
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 112 ± 6 aa |
| Standard deviation of domain lengths | 5.59 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 26.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R6MTZ8 | 64-187 | KVVQNESEESSFKYYIGQNRKKKFKCIIDKDKQKYGQWKRFCQASVDTFDIWFTRTANAPSNSVSINEIGIYSETGFIDEPSEDKAV… |
| A0A5Q0P242 | 21-140 | VNHAHKLNSDSPFQYYVGTYRSNIFSVGLKRGDTYGEWAELGAIRGGIFPLLYTTQPQALNGIKRGTNGLVEQEIEFSGSDIQGKKV… |
| A0A839IX10 | 825-933 | None |
| J0HP57 | 328-439 | None |
| A0A1S9CJR7 | 824-934 | None |
| A0A2X5A6X9 | 133-248 | None |
| A0A851IMG3 | 772-878 | None |
| A0A839ITI5 | 613-723 | None |
| A0A1S9CRV6 | 381-489 | None |
| I9U5C0 | 2-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.