DPCstruct | MC13346
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 135 ± 8 aa |
| Standard deviation of domain lengths | 8.39 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 25.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0314 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D0CY07 | 14-144 | AQQEVIEQRVRQIVAKALELDVDEVQLSSSLVDELGAESLDLLDIAFMLERAFKIEFPRIDILERAAGHFGEESLVVDGVVTDFGLA… |
| A0A0C5WU23 | 4-147 | VFKDKVIEIIAEVLELENDEVGLDDALVDDLGADSLDIVDLSFSLGKTFKIQMPQKSVIAHALEVADEDSVFVVNERLTAKGAELLQ… |
| A0A2V2RZ42 | 60-192 | None |
| A0A523QUQ2 | 128-255 | None |
| A0A3E0Q8V1 | 12-144 | None |
| A0A843S3D7 | 1-132 | None |
| A0A2E6EKD1 | 23-171 | None |
| A0A522TEQ5 | 29-163 | None |
| A0A812P4C3 | 185-309 | None |
| A0A2M8BNB5 | 1-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.