DPCstruct | MC13345
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 127 ± 25 aa |
| Standard deviation of domain lengths | 25.16 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 80.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 36.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183FJ00 | 952-1065 | LLPEDEEWIADRLGTFDNYIHDQRRSVRLMGQLFNAAASALPAYSSLEDDLSTHRVTATIPNLDSYPLRLRFQLSDMISEAGWMKHR… |
| A0A7I4Z399 | 14-129 | KEWIADRATSFTNYPRNPAEARRRMAQLFNAACLALVAVNALDDDKSTHRLTATVPSMCAFPFRFDFVITDMSPECGWTNHRPVYLW… |
| A0A7I4Z536 | 33-150 | None |
| A0A368GEN4 | 305-451 | None |
| A0A368FPB7 | 126-252 | None |
| A0A183F9E2 | 3-119 | None |
| A0A183FCB7 | 28-145 | None |
| A0A183FJ58 | 152-267 | None |
| A0A183F515 | 78-198 | None |
| A0A7I4YVU8 | 588-773 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.