DPCstruct | MC13344
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 93 ± 11 aa |
| Standard deviation of domain lengths | 10.77 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 70.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 48.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I8A653 | 5-80 | GVKGVLQGREIYWCPDGGGHTPYCPGPIDPDDRIYCCTWYAGTGDIPSCCKHPIATATLATIYVAAFVGALWLFFI |
| A0A7I4YZH1 | 7-94 | VLSGRPIYWCPDGEGHLPFCPSPTDPDTSVYCCQFFYLGDTFPSCCRLPIYTGLLVALIICAVLFGLLIVFLYCWFWPNSLLNVQRRR |
| A0A1I7VZT5 | 11-83 | None |
| A0A2A6BG11 | 3-98 | None |
| A0A0D8Y2G9 | 1-98 | None |
| Q21516 | 33-126 | None |
| A0A7E4VQN9 | 191-284 | None |
| A0A6V7TMI1 | 92-194 | None |
| A0A3P8BIA1 | 7-96 | None |
| A0A3P6S7F8 | 4-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.