DPCstruct | MC13343
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 229 ± 70 aa |
| Standard deviation of domain lengths | 70.10 |
| Length coefficient of variation | 0.31 |
| Mean AlphaFold2 pLDDT confidence score | 72.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 16.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B6IE43 | 962-1091 | NKKKHFTCSLCHKKIEGQIGRVESREDKLILMIAAILDHRFEMDIAASFVRSRREFIVCSQHFQSAIDRIFLFLSIKHMNQLSMCRQ… |
| A0A7I4YXB9 | 3-234 | HMVFCDICNRKRPVKGARNASCQPKRNAVLLACLVKLNIISLNRARRIFDELVQTTTPTRNHKRFCREHYAESVSFLAAMVEMRTGR… |
| A0A368G4A1 | 2-165 | None |
| A0A368G491 | 1-227 | None |
| A0A0B1S9N0 | 229-408 | None |
| A0A368G168 | 232-665 | None |
| A0A368G0Z5 | 244-506 | None |
| A0A2H2IEU7 | 306-480 | None |
| A0A2H2HYQ1 | 641-763 | None |
| A0A0M3I943 | 107-322 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.