DPCstruct | MC13342
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 89 ± 15 aa |
| Standard deviation of domain lengths | 14.60 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 38.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5S6PSW8 | 2-73 | ITTNTRCIACTRAAAFRTNIDGQDTIAQCSSGNDVRDRCQGCCEVYAIYNGRQKAEAASFPSKDGSCICCMT |
| A0A7I4YLI1 | 1-101 | MHLVLVAVLVAIVSAQVFPDARFNPATEPLPCGFSCSRRTAVTAVIDGVFSRAECSDRNGNIMARCSSCCAMKALSEGLTTDRASGL… |
| A0A183UCC3 | 14-83 | None |
| W2SIE1 | 77-163 | None |
| G0MHW4 | 1-106 | None |
| A0A7I4YID8 | 26-136 | None |
| A0A0N4Y0D2 | 30-121 | None |
| A0A0N4U431 | 26-96 | None |
| W6NUX4 | 106-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.