DPCstruct | MC1334
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 169 ± 17 aa |
| Standard deviation of domain lengths | 17.19 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 75.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 34.05 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | PF19421- PF14225 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A286XS89 | 148-331 | IQHFENPNQFCKDIAERIAQVCLEEKNAKLSNLAHVMTLYKTHSYTRDCGTWVSVVCRYLHEAYADITLNMVTYLAELLEKGLPSMQ… |
| A0A1B0CXC3 | 1-157 | PQVSSELGSKLENLGTVMILYSRKTFSKESFQWTKCVVKYLYDTYAHMGLHMLAFLIEVLEKGWQQVQLQVLSVLHCMLHYIDLSSA… |
| A0A7J7B1M1 | 871-1063 | None |
| H2Y333 | 2-147 | None |
| A0A3P7ZWC6 | 2-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.