DPCstruct | MC13339
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 325 ± 35 aa |
| Standard deviation of domain lengths | 35.26 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 23.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G1LDY6 | 2-297 | IIPNVTEFRLHVPGVIPLVTDGKGQLQPLRAPSNTSGPEDIPEDLLGKGDPFSFHKPKDAPAGLYDLVVTGLGSEPQYVAKAANGDL… |
| A0A2G5HJH5 | 9-333 | GFPQPTANNAPCMIDPTKKTEQFNLLDYEFMPIVASGTTTLIPLAAPTSEAQANAMGDASKYPLPVYYFEKPANAPDGVYDIVMLVG… |
| A0A7C8NZ89 | 93-431 | None |
| A0A4T0W4V7 | 13-337 | None |
| M1VZ42 | 80-448 | None |
| A0A6G1IP19 | 19-368 | None |
| A0A6A6AE34 | 221-535 | None |
| A0A178DWA7 | 57-417 | None |
| A0A6A6W9J3 | 5-308 | None |
| A0A4V5N3G3 | 1-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.