DPCstruct | MC13338
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 217 ± 18 aa |
| Standard deviation of domain lengths | 17.70 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 31.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03980 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A179FXN2 | 9-201 | NPNPNPEPGPRAIRLHQVYTGALTRTLDKLSYENIATCYPTISRRAAPILHQVHAQMVERLKEKCDKEFDSILATRDVVRKMNDLEG… |
| A0A6G1LBQ4 | 3-224 | TETPAPPADGTTHLQQSRSPSPVAPPPLSAAPGPRASAIQKLYQDAITHILKTCNYDNFASCFPTPAQNVSPSMKQLHENFLEKIRE… |
| A0A433QZ85 | 62-275 | None |
| A0A6P4XUZ7 | 30-273 | None |
| A0A6P8JBV9 | 1-209 | None |
| R4XBU9 | 4-187 | None |
| A0A1J7JV10 | 1-233 | None |
| L7JCR0 | 44-275 | None |
| A0A0M8N1M1 | 67-276 | None |
| A0A8A3P608 | 1-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.