DPCstruct | MC13337
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 103 ± 6 aa |
| Standard deviation of domain lengths | 6.38 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6P5A7 | 81-176 | QPIPISHIWPLFTEQLTLAPEPLPANSFVKQHSLLDYGDTPASTSLSTLLLNEAQIFEVLRKHPHTNIVEYHGCLVKDERIVGLGFV… |
| A0A6G1LBF7 | 1-98 | MPEDICTYSLKQLDTAKLFIKRPKIASYLGSTVLADRFLIEVETHNLTKRNPHPNLVQFQGCIARNGRATGLILRRYAGTLMDVVGD… |
| A0A135RYN3 | 450-548 | None |
| A0A1B7MT17 | 65-167 | None |
| A0A0P7BLF6 | 1000-1112 | None |
| A0A0D0B608 | 61-166 | None |
| A0A139HN15 | 467-577 | None |
| A0A168H5U1 | 22-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.