DPCstruct | MC13336
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 381 ± 32 aa |
| Standard deviation of domain lengths | 32.02 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 73.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 19.76 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | PF04912- PF10271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S2MNS9 | 6-395 | KYADLPWIAHGQPDVYEAGELPEVDQRLSRTALEDEMLPKEIEKLRLSVSDAHKRFASCKVDSSKVDFSDSIAGTGKRGYTIETDEY… |
| A0A6G1L2I7 | 1-367 | MAETSRLAALPGYDTAPDVYETPDLTDDSNTTVLTEQTSPRSAPESSQSSEEDDEDDEETNGVLRRRLYPQRARSRFDGARVGGRGV… |
| A0A2G5B5P9 | 1-385 | None |
| T1FUU5 | 12-401 | None |
| A0A3M7LWY5 | 358-776 | None |
| A0A0S6XSN4 | 27-461 | None |
| A0A1D8NM14 | 3-336 | None |
| A0A5E8BP83 | 5-400 | None |
| A0A482WRQ3 | 3-332 | None |
| A0A814UQ26 | 197-555 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.