DPCstruct | MC13335
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 100 ± 10 aa |
| Standard deviation of domain lengths | 9.81 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 33.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7H8QR76 | 595-697 | SVAHLNRYLNRRLSLRNDSIDLSPYPLVLCHMDFVRRNMILGEDRKSIYLLDWAHAGFYPRFYELAALPCMSPYDEPYEKPLIAAVE… |
| A0A6G1KXP4 | 2-96 | LEKYLNSRLRSIAEKLDLAKSDMVLCHLDVAPRNVVLTGQKLWLLNWEAAGFYPRGFEYCALRVNRGRNGEDSLFAEMLEKCLVALE… |
| A0A1J9P6D0 | 304-398 | None |
| A0A1B8E3B4 | 156-266 | None |
| A0A4Z1IIQ5 | 87-200 | None |
| A0A420NBV7 | 4-86 | None |
| F2TF81 | 61-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.