DPCstruct | MC1333
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 113 ± 21 aa |
| Standard deviation of domain lengths | 20.81 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 81.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 39.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10183 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9P3X9 | 1-66 | MHATFFFSVTCCLVFGSFIFAYVPDFQLRDWAQREAFLELRRREHLGLPPIDKNLIDPEKIVLPTD |
| A0A1B0CV98 | 24-150 | TRAISTSPKNSETEPISPTTPIDTTKLDAELKKNWMSYGFETKDEYQDRSQTKASFFFTITLCIVWGSFIYAYLPDYRLRDWAQREA… |
| A0A452U040 | 24-140 | None |
| A0A7J6Z3C5 | 135-262 | None |
| A0A182FDE3 | 495-617 | None |
| A0A195CKB8 | 12-135 | None |
| A0A131ZY62 | 39-162 | None |
| A0A7I8V7A7 | 26-155 | None |
| A0A310SUN2 | 145-265 | None |
| A0A803TUB3 | 43-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.