DPCstruct | MC13329
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 243 ± 31 aa |
| Standard deviation of domain lengths | 30.55 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 15.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W8ILU6 | 1-291 | MSEQDEKATDQPVNRIRHYADILNPLFWCDDFNQVHRMFEWACTMVRVTGMQDTGWDSYTESIAFLEDCSQLQRLQLPEDSFPNPAN… |
| A0A2N2CSA1 | 25-280 | YYYESFIRYLNIFFDVFEAAFNKCEFSSLLTLLSVRGIEDAGWDPYKSSIQIIDSIIDATDKIHIKEVQRNIHLWVYGHIMEASEPY… |
| A0A4R5VF84 | 69-336 | None |
| A0A371J3X6 | 54-270 | None |
| A0A353NY87 | 12-222 | None |
| G2E4I2 | 54-266 | None |
| A0A4R4AW60 | 300-546 | None |
| A0A352R5U4 | 19-277 | None |
| A0A1T4P074 | 5-267 | None |
| X1AKJ2 | 13-263 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.