DPCstruct | MC13328
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 91 ± 9 aa |
| Standard deviation of domain lengths | 9.16 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 31.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02583 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A535PPC9 | 2-79 | ETRLRRIEGQVRGIQKMVAEDRYCIDVLTQVNATRAALESVALQLLADHTEHCVTEAIRSGGGKAKVRELNDAVERLV |
| A0A2N2CQT8 | 4-91 | TKHRDEDELRSLMNRLSRIEGQVRGVKKMLEDEAYCTDVLTQVTAIQAALNAFNRELLANHIKSCVVDDIRNGSNEVVDDLVATLQKL |
| A0A7X1U1R0 | 16-112 | None |
| A0A1F4PPJ9 | 4-82 | None |
| A0A7Y0L4X4 | 3-88 | None |
| A0A522QG57 | 80-177 | None |
| A0A5C8T6Z4 | 16-107 | None |
| E8LDF4 | 31-121 | None |
| A0A7W4H0Y0 | 3-84 | None |
| A0A7T9C9K7 | 7-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.