DPCstruct | MC13326
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 178 ± 22 aa |
| Standard deviation of domain lengths | 22.34 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 30.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q4PZI7 | 583-774 | FATSILRAIGAFLLIYSLLIMGLSPWLLRLLYLGKFWEQQCWFFGFEGYMDLETIETQIFGGRLGRMKWTAAASPLSRHERNVHGEC… |
| A0A6A6CW33 | 1-168 | MILVAGPALLKNMYYGKFWTTQARFFGVQGLADINMIERSLFGLSVGESNEGRLKWSTSGSLQSSGTKETESGHFEGVAPASLPEKD… |
| A0A166SGA8 | 486-684 | None |
| A0A0D2Y2G3 | 253-445 | None |
| A0A4U0XZN4 | 1004-1204 | None |
| A0A1V6S125 | 165-333 | None |
| K2SYK6 | 439-584 | None |
| A0A163FTF6 | 751-922 | None |
| A0A1B7MW15 | 348-480 | None |
| A0A0D0AH98 | 511-683 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.