DPCstruct | MC13324
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 181 ± 20 aa |
| Standard deviation of domain lengths | 20.11 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 29.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7D3VY83 | 1-198 | MQPLLELRNKLDVRNDEGRRDDKHLRDWRKMNGSIQLFNDQVVHGPYTQESRANWLRELLNAQTWVRKNGPDSVRNIELITISELHE… |
| J4X1C7 | 166-345 | EWMLPLLEFRNEFGDLAHDRERRSFRRMRGHLQGSHGQLFHGPYKREVRERWLRRLLEIQKKIRETGPEEFRDLELIHHEELQAIRR… |
| A0A4R1QR29 | 276-446 | None |
| A0A6P2SX60 | 110-322 | None |
| K0EPK0 | 87-305 | None |
| A0A7C6ABT9 | 107-293 | None |
| M3UZA4 | 601-798 | None |
| A0A7I6XWT6 | 5-176 | None |
| A0A645HNP0 | 12-178 | None |
| A0A419GN27 | 166-325 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.