DPCstruct | MC13322
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 284 ± 47 aa |
| Standard deviation of domain lengths | 47.41 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 88.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 21.17 |
| Pfam Score | 88.42 |
| Assigned Pfam label(s) | PF10228- PF00173- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J9K6R0 | 215-499 | LKTKISELFLVDEMPKEFYDLWSFCKRQCSTHPEDALLSVGLKLVGPYDVLAGHMNGFNTNDIEKTVLHWRYYYDPPEFQTIIASTG… |
| A0A7D3VNH1 | 7-284 | EQRVLHDMELRPYGIMNLFDDPACLPREGLDVRVHGRYYRDPPEFLTFMHGGTDGLHFGLWYDDGRTCTGVASYYNNDGGGVGLPSG… |
| A0A2P8YE00 | 143-442 | None |
| A0A4Y7M401 | 113-423 | None |
| D3PZ98 | 172-477 | None |
| A0A7R9KC60 | 263-570 | None |
| A0A7V1RE89 | 20-463 | None |
| A0A2N1T3Q8 | 59-364 | None |
| A0A0M3HU22 | 532-865 | None |
| A0A6J6BR80 | 77-311 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.