DPCstruct | MC13321
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 245 ± 42 aa |
| Standard deviation of domain lengths | 42.03 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 75.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 25.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10225 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H0X9W3 | 35-286 | SMGILASLLIIIFILYKFMPKKSPIYVILVGGWSFSLYLIQLVFKNLQEIWRCYWQYLLSYVLTVGFVSFAVCYKYGPLENERNINL… |
| A0A0N4UMF4 | 69-274 | RIWKINYIRAGIYIGGIVLFFMSHSLVRNVIFYYTSGCTVGVIASLLLVGFVVYRFTPKKWFGFPLLISGWSFSLYIFYMIWRNFAM… |
| A0A3P8E1U2 | 2-200 | None |
| A0A1S3MGJ0 | 37-305 | None |
| A0A834AXU9 | 19-248 | None |
| T1KPL8 | 29-290 | None |
| A0A388KY37 | 145-352 | None |
| A0A1Y1KE15 | 2-191 | None |
| A0A1X7SLH3 | 1-232 | None |
| A0A1Q9D327 | 200-502 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.