DPCstruct | MC13318
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 90 ± 4 aa |
| Standard deviation of domain lengths | 4.35 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 31.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0061 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W4V7C8 | 1-88 | MPRMDQLKTPVFDAVKRYVDSNVIQFHVPGHKQGAGLAELREYIGERALRMDANGMEDLDFANNPTGVIYESEMLAAQAFGAQHAYFW |
| A0A6V8PKW2 | 1-89 | MHKMDQTRTPYIEGLIKYVKENRLPFHMPGHKQGQGIHPLLKKILGDEVFQYDLTEVDGVYYLHNPTGILKEAQDLAAELYKVDQPI… |
| A0A7N0USG4 | 72-160 | None |
| A0A2X1TBV0 | 1-86 | None |
| I5CB54 | 109-197 | None |
| A0A2G9HD37 | 79-163 | None |
| A0A6G3ABC9 | 1-100 | None |
| A0A1F6HUA2 | 1-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.