DPCstruct | MC13317
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 102 ± 16 aa |
| Standard deviation of domain lengths | 16.27 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 18.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20586 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2M7S4B3 | 7-123 | LSKIRQRINQLSQERVTLETKLMRIGYLNPGALYWRYIECRKRGCQCQKDKKYRHGPYPYLTYVEEGRIKVRYVGKEELSIVEEGAS… |
| A0A6V8PIK6 | 5-120 | ISKMRQEMGRLSRERWGLEKELAGVLSRKFLLKGSLVQKYKACNKPGCRCTRGELHGPFCYLSVSQGGKTKMIFIKKHLWSQAKELS… |
| R7BKR4 | 9-110 | None |
| A0A356IYB5 | 39-133 | None |
| A0A7V3H6C9 | 1-82 | None |
| A0A257QHM3 | 6-106 | None |
| A0A1X1MGV2 | 12-115 | None |
| A0A351L4I1 | 97-221 | None |
| A0A414RGF5 | 4-87 | None |
| A0A417FUD2 | 5-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.