DPCstruct | MC13313
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 141 ± 25 aa |
| Standard deviation of domain lengths | 24.59 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 89.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 35.84 |
| Pfam Score | 95.83 |
| Assigned Pfam label(s) | CL0179- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V8NYM7 | 16-144 | MPGMMDTVLNLGLNETTMEALIKKTKNDRFAYDAYRRFITMFGSIVMGVDRQKFERALEEIKEKKGVHLDTDLTAADLKDIVDEFKV… |
| A0A0F3N8Z9 | 42-164 | LVSVRSGSVQSMPGMLDTVLNVGLNDEVAVKLGAMRGGRFAYDSYRRLIQMYAASVLQLEDRIFEERYKEKQKELSLSAGESITNQE… |
| A0A812S062 | 88-214 | None |
| A0A812TQ27 | 4-116 | None |
| A0A380FM77 | 1-112 | None |
| A0A7C4NU46 | 619-775 | None |
| A0A7Y2YI69 | 705-891 | None |
| A0A1Z1WQJ5 | 98-224 | None |
| A0A837PLF7 | 25-147 | None |
| A0A3M1GAR8 | 865-1020 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.