DPCstruct | MC13312
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 88 ± 8 aa |
| Standard deviation of domain lengths | 8.01 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 94.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 34.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y4Z9D4 | 42-135 | VLATGAAGIELLTEEQWRHNTNIELIADANATPPLGIGGTDMMDKGIERHGKIIWGAIGFGALKLALHRACIAKLFEANTQVFDAEN… |
| A0A6V8NYJ3 | 3-83 | RELWTANPTIEVMADVNAVPPAGIEGLEVRDDGTEREGKKCLGPLAIGSLKMRTHKECLRRLFTRNDLILDIKEVYEVSKE |
| X1I2S6 | 15-112 | None |
| A0A7V5Q0K8 | 154-245 | None |
| A0A7V3NA71 | 52-133 | None |
| A0A6N8VIP5 | 182-275 | None |
| A0A846PBM4 | 10-86 | None |
| A0A8B3LSE6 | 93-190 | None |
| A0A836RGA9 | 5-80 | None |
| W7W422 | 13-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.