DPCstruct | MC13311
Metacluster Properties and Pfam Annotations
| Number of structural domains | 77 |
|---|---|
| Mean domain length (aa) | 214 ± 47 aa |
| Standard deviation of domain lengths | 46.51 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 93.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 21.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01314 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V8NUF4 | 31-238 | GQRKDIGDTLAEGLMRTAEKLGLQGHAVQIKGLEIPGYDVRGPVGMALAYTTADRGGDHLRAWTIVAELDDPFTITGKAKLTKELQD… |
| A0A7C4XJI8 | 65-311 | KREGIGDILAKGVYWAAREIGKGAEKFDHNTIKKHEQIPIKLGMLNPIYFIMWSTGEKINITQIEGQIPQAPLPKEAREDFVKDWPQ… |
| A0A7U9BDG2 | 124-387 | None |
| A0A847N004 | 2-254 | None |
| A0A7C4GJ51 | 30-242 | None |
| A0A7V1N2K3 | 13-191 | None |
| A0A257SS56 | 216-466 | None |
| A0A662VCF9 | 82-401 | None |
| A0A1J4T5N8 | 191-413 | None |
| A0A7R9NDZ0 | 14-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.