DPCstruct | MC13310
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 110 ± 12 aa |
| Standard deviation of domain lengths | 11.99 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 22.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0177 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V8NQK7 | 4-112 | HDNSMKAVAAKLVDGAAVDSLVYDYALARGFQYIARTKIIWKSPPYGAPPIVVHPRLNSELKTQLRDVFLTMDQDEEGRRILQDLMI… |
| A0A7Y8E514 | 6-96 | REGRADLAAVDSVTYDYLARFAPEEVAGLRTVTRSAPSPTLPFIGPLHLSDEQVAHIREVMNQALQDLPHVVATLGIQAVLPASEDD… |
| A0A1S2L694 | 84-201 | None |
| K1XWF4 | 2-125 | None |
| A0A2N1PPW5 | 16-136 | None |
| A0A1G3ZQN2 | 1-100 | None |
| A0A2M7CMG1 | 17-116 | None |
| A0A143HST3 | 1-96 | None |
| A0A534SUQ4 | 71-181 | None |
| U3U624 | 10-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.