DPCstruct | MC1331
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 176 ± 32 aa |
| Standard deviation of domain lengths | 32.01 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 81.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11262 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7VLV6 | 31-205 | QQRQFIVFRDSAEYPLKLATQMLDQCQETFVQFFHFLRTNLKPEQYSKRLPSALELLTDYHLSVDAMFCLMRPVYMNEIGTSYELAK… |
| A0A1B0CNM8 | 1-177 | MAQQKHCVIYRETAHSHLKLVGKLYDQCQDTLVQFGTFLGSTYTVEEYMERLPSIHSMLQEYHIHSDVAFFLARPMFSHQINQKYDQ… |
| A0A835RQ69 | 142-328 | None |
| A0A817NHN1 | 3-131 | None |
| F4NSU7 | 819-1105 | None |
| A0A180G634 | 192-376 | None |
| A0A1R3IRD1 | 4-154 | None |
| B2KI97 | 731-909 | None |
| A0A1X7SUE4 | 2-148 | None |
| A0A815IWS4 | 29-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.